PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr5g085860.1
Common NameMTR_5g085860
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family TALE
Protein Properties Length: 299aa    MW: 34365 Da    PI: 6.9298
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr5g085860.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.99.5e-102282622155
                      HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
         Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                      k +yps+++++ LA+++gL+ +q+ +WF N+R ++
  Medtr5g085860.1 228 KWPYPSESQKQALAESTGLDLKQINNWFINQRKRH 262
                      569*****************************885 PP

2ELK38.52.4e-13182203122
              ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                      ELK qLlrKYsgyLgsLk+EF+
  Medtr5g085860.1 182 ELKVQLLRKYSGYLGSLKKEFL 203
                      9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.5E-134488IPR005540KNOX1
PfamPF037905.7E-194687IPR005540KNOX1
SMARTSM012562.4E-2599150IPR005541KNOX2
PfamPF037911.2E-21102147IPR005541KNOX2
PfamPF037891.8E-9182203IPR005539ELK domain
SMARTSM011887.1E-7182203IPR005539ELK domain
PROSITE profilePS5121311.139182202IPR005539ELK domain
PROSITE profilePS5007112.163202265IPR001356Homeobox domain
SMARTSM003897.3E-12204269IPR001356Homeobox domain
SuperFamilySSF466892.44E-19204276IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.0E-28207268IPR009057Homeodomain-like
CDDcd000861.13E-11214266No hitNo description
PfamPF059202.2E-17222261IPR008422Homeobox KN domain
PROSITE patternPS000270240263IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MDHQNQMMNM ETNRKFFSFP LSNNSSGVQN HHNYTQHQNN TNNNTCRDKI MAHPLFPRLL  60
SSYLNCLKVG APPEVVASLE ESCAKCEILN GSSGRTGSSS SCIGEDPGLD QFMEAYCEML  120
IKYEQELTKP FKEAMLFLSR IESQLKAVAV STDFGQSEFA ASQNEIDVHE NNLDTTQGED  180
QELKVQLLRK YSGYLGSLKK EFLKKKKNGK LPKEARQQLL DWWSRHYKWP YPSESQKQAL  240
AESTGLDLKQ INNWFINQRK RHWKPSEDMQ FAVMDATNYY MENVMCKPFP MDAMPMLL*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mtr.175760.0stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1280610.0EF128061.1 Medicago truncatula class I KNOX homeobox transcription factor (KNOX6) mRNA, complete cds.
GenBankGU4616040.0GU461604.1 Medicago truncatula KNOX6 variant a mRNA, complete cds, alternatively spliced.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003616932.20.0homeobox knotted-like protein
SwissprotP466081e-114HSBH1_SOYBN; Homeobox protein SBH1
TrEMBLD4NXR40.0D4NXR4_MEDTR; Homeobox knotted-like protein
STRINGGLYMA14G05150.21e-161(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20393480
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.11e-101KNOX/ELK homeobox transcription factor
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]